Kv9.3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81334

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kv9.3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kv9.3 Antibody [NBP1-81334]

Immunohistochemistry-Paraffin: Kv9.3 Antibody [NBP1-81334]

Immunohistochemistry-Paraffin: Kv9.3 Antibody [NBP1-81334] - Staining of human gallbladder shows moderate membranous positivity in glandular cells.
Kv9.3 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Kv9.3 Antibody [NBP1-81334]

Immunocytochemistry/ Immunofluorescence: Kv9.3 Antibody [NBP1-81334]

Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Applications for Kv9.3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv9.3

Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. (provided by RefSeq)

Alternate Names

delayed-rectifier K(+) channel alpha subunit 3, KV9.3, MGC9481, potassium voltage-gated channel subfamily S member 3, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3, Shab-related delayed-rectifier K+ channel alpha subunit 3, voltage-gated potassium channel protein Kv9.3, voltage-gated potassium channel subunit Kv9.3

Gene Symbol

KCNS3

Additional Kv9.3 Products

Product Documents for Kv9.3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv9.3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv9.3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv9.3 Antibody - BSA Free and earn rewards!

Have you used Kv9.3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...