LANCL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81796

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LANCL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LANCL1 Antibody - BSA Free

Western Blot: LANCL1 Antibody [NBP1-81796]

Western Blot: LANCL1 Antibody [NBP1-81796]

Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: LANCL1 Antibody [NBP1-81796]

Immunocytochemistry/ Immunofluorescence: LANCL1 Antibody [NBP1-81796]

Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.
Western Blot: LANCL1 Antibody [NBP1-81796]

Western Blot: LANCL1 Antibody [NBP1-81796]

Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796]

Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Applications for LANCL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LANCL1

The LANCL1 gene encodes a peripheral membrane protien related to the LanC family protiens that are invoved in the biosynthesis of antimicrobial peptides. Previously, this protein was thought to be a part of the G-protien-coupled receptor superfamily, but it has been found that it is indeed in the LanC family. The protien might play a role as a peptide-modifying enzyme in eukaryotic cells.

Alternate Names

40 kDa erythrocyte membrane protein, LanC (bacterial lantibiotic synthetase component C)-like 1, LanC (bacterial lantibiotic synthetase component), LanC lantibiotic synthetase component C-like 1 (bacterial), lanC-like protein 1, p40GPR69AG protein-coupled receptor 69A

Gene Symbol

LANCL1

Additional LANCL1 Products

Product Documents for LANCL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LANCL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LANCL1 Antibody - BSA Free

Customer Reviews for LANCL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LANCL1 Antibody - BSA Free and earn rewards!

Have you used LANCL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies