MafB Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81342
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Rat (98%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Cited:
Immunohistochemistry-Paraffin, Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 25053437).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MafB Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: MafB Antibody [NBP1-81342]
Immunocytochemistry/Immunofluorescence: MafB Antibody [NBP1-81342] - Staining of human cell line hTCEpi shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342]
Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human parathyroid gland shows moderate to strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342]
Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human kidney shows moderate to strong nuclear positivity in podocytes.Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342]
Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342]
Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human lung shows moderate to strong nuclear positivity in macrophages.Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342]
Immunohistochemistry-Paraffin: MafB Antibody [NBP1-81342] - Staining of human pancreas shows moderate to strong nuclear positivity in islets of Langerhans.Chromatin Immunoprecipitation-exo-Seq: MafB Antibody - BSA Free [NBP1-81342]
ChIP-Exo-Seq composite graph for Anti-MAFB (NBP1-81342) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Immunocytochemistry/ Immunofluorescence: MafB Antibody - BSA Free [NBP1-81342] -
Increased contractility in spinous cells of adult epidermis induces some granular markers in adult epidermis.(A and B) Immunofluorescence staining of MafB in back skin (A) or glabrous skin (B) in red, and suprabasal cells expressing Arhgef11CA marked by HA (green) in adult K10-Arhgef11 and controls. Mice were fed with doxycycline since adulthood. Insets show close-ups of HA+ cells in suprabasal layers adjacent to basal cells. Scale bars: 20 μm. (C and D) Immunofluorescence staining of Tgm1 in back skin (C) or glabrous skin (D) in red, and suprabasal cells expressing Arhgef11CA marked by HA (green) in adult K10-Arhgef11 and controls. Insets show close-ups of HA+ cells in suprabasal layers adjacent to basal cells. Mice were fed with doxycycline since adulthood. Scale bars: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40772711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MafB Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization, Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-81342 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MafB
Long Name
v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog B
Alternate Names
KRML
Gene Symbol
MAFB
Additional MafB Products
Product Documents for MafB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MafB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MafB Antibody - BSA Free
Customer Reviews for MafB Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used MafB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Whole cell lysateSpecies: HumanVerified Customer | Posted 06/07/2016Cell lysate. Lane 1= monocytes, lane 2= monocyte-derived macrophages
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...