MCCC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05091

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCCC1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human MCCC1 (NP_064551.3). VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MCCC1 Antibody - BSA Free

Western Blot: MCCC1 AntibodyBSA Free [NBP3-05091]

Western Blot: MCCC1 AntibodyBSA Free [NBP3-05091]

Western Blot: MCCC1 Antibody [NBP3-05091] - Analysis of extracts of various cell lines, using MCCC1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
MCCC1 Antibody - BSA Free

Western Blot: MCCC1 Antibody - BSA Free [MCCC1] -

Western Blot: MCCC1 Antibody - BSA Free [MCCC1] - Western blot analysis of various lysates, using MCCC1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
MCCC1 Antibody - BSA Free

Immunohistochemistry: MCCC1 Antibody - BSA Free [MCCC1] -

Immunohistochemistry: MCCC1 Antibody - BSA Free [MCCC1] - Immunohistochemistry analysis of paraffin-embedded mouse kidney using MCCC1 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
MCCC1 Antibody - BSA Free

Immunohistochemistry: MCCC1 Antibody - BSA Free [MCCC1] -

Immunohistochemistry: MCCC1 Antibody - BSA Free [MCCC1] - Immunohistochemistry analysis of paraffin-embedded rat liver using MCCC1 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for MCCC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:100

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MCCC1

MCCC1, also known as Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial, is a 725 amino acid protein that is 80 kDa, located in mitochondrion matrix, functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Studies on this protein have shown a relationship with the following diseases and disorders: 3 methylcrotonyl-coa carboxylase 1 deficiency, pseudomyxoma peritonei, mucinous cystadenocarcinoma, cystadenocarcinoma, 3-methylcrotonyl-coa carboxylase deficiency, carnitine deficiency, neisseria meningitides, Parkinson's disease, hypotonia, pneumonia, and tuberculosis. This protein has also been shown to have interactions with PPP2R2B, YWHAB, ACADM, AUH and ECHS1 in valine, leucine and isoleucine degradation, metabolic pathways, metabolism of amino acids and derivatives, and branched-chain amino acid catabolism pathways.

Alternate Names

3-methylcrotonyl-CoA carboxylase 1, DKFZp686B20267, EC 6.4.1, EC 6.4.1.4, MCCAFLJ25545, MCC-B, methylcrotonoyl-CoA carboxylase 1 (alpha), methylcrotonoyl-Coenzyme A carboxylase 1 (alpha), mitochondrial

Gene Symbol

MCCC1

Additional MCCC1 Products

Product Documents for MCCC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCCC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCCC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCCC1 Antibody - BSA Free and earn rewards!

Have you used MCCC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies