Methyltransferase like 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82284

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Methyltransferase like 3. Peptide sequence: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methyltransferase like 3 Antibody - BSA Free

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284]

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284]

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - WB Suggested Anti-METTL3 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: Human Thymus
Immunohistochemistry: Methyltransferase like 3 Antibody [NBP2-82284]

Immunohistochemistry: Methyltransferase like 3 Antibody [NBP2-82284]

Immunohistochemistry: Methyltransferase like 3 Antibody [NBP2-82284] - Human Intestine
Western Blot: Methyltransferase like 3 Antibody [NBP2-82284]

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284]

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - Host: Rabbit. Target: METTL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 1ug/ml

Applications for Methyltransferase like 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Methyltransferase like 3

Methyltransferase like 3 encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Alternate Names

adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase, EC 2.1.1.62, IME4, M6A, methyltransferase like 3, Methyltransferase-like protein 3, MGC4336, mRNA m(6)A methyltransferase, MTA70, MT-A70, N6-adenosine-methyltransferase 70 kDa subunit, Spo8

Gene Symbol

METTL3

Additional Methyltransferase like 3 Products

Product Documents for Methyltransferase like 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methyltransferase like 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methyltransferase like 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methyltransferase like 3 Antibody - BSA Free and earn rewards!

Have you used Methyltransferase like 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...