MIG2/Kindlin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87884

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MIG2/Kindlin-2 Antibody - BSA Free

MIG2/Kindlin-2 Antibody - BSA Free Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.
MIG2/Kindlin-2 Antibody - BSA Free Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Staining of human skin shows very weak cytoplasmic positivity in squamous epithelial cells.
MIG2/Kindlin-2 Antibody - BSA Free Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
MIG2/Kindlin-2 Antibody - BSA Free Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Immunohistochemistry-Paraffin: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.
MIG2/Kindlin-2 Antibody - BSA Free Western Blot: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Western Blot: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Analysis in human cell line SiHa.
MIG2/Kindlin-2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Immunocytochemistry/ Immunofluorescence: MIG2/Kindlin-2 Antibody - BSA Free [NBP1-87884]

Staining of human cell line U-2 OS shows localization to nucleoplasm & focal adhesion sites.

Applications for MIG2/Kindlin-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MIG2

Participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites

Long Name

Mitogen Inducible Gene 2

Alternate Names

FERMT2, KIND2, Kindlin-2, PLEKHC1

Entrez Gene IDs

10979 (Human)

Gene Symbol

FERMT2

UniProt

Additional MIG2 Products

Product Documents for MIG2/Kindlin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MIG2/Kindlin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MIG2/Kindlin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MIG2/Kindlin-2 Antibody - BSA Free and earn rewards!

Have you used MIG2/Kindlin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MIG2/Kindlin-2 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I bought an antibody named kindlin-2(NBP1-87884) for IHC a few days ago. I want to know the antigen retrieval condition your lab has employed.

    A:

    Our lab used a heat mediated citrate buffer pH 6.0 antigen retrieval method that can be found in our antigen retrieval protocol.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...