MIS/AMH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70639

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to AMH(anti-Mullerian hormone) The peptide sequence was selected from the middle region of AMH. Peptide sequence SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MIS/AMH Antibody - BSA Free

Western Blot: MIS/AMH Antibody [NBP1-70639]

Western Blot: MIS/AMH Antibody [NBP1-70639]

Western Blot: MIS/AMH Antibody [NBP1-70639] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: MIS/AMH Antibody [NBP1-70639]

Immunohistochemistry: MIS/AMH Antibody [NBP1-70639]

Immunohistochemistry: MIS/AMH Antibody [NBP1-70639] - Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-AMH antibody
Western Blot: MIS/AMH Antibody [NBP1-70639]

Western Blot: MIS/AMH Antibody [NBP1-70639]

Western Blot: MIS/AMH Antibody [NBP1-70639] - Titration: 1 ug/ml Positive Control: Human Fetal Small Intestine cell lysate.

Applications for MIS/AMH Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MIS/AMH

Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Mullerian-inhibiting Substance/Anti-Mullerian Hormone

Alternate Names

AMH

Gene Symbol

AMH

Additional MIS/AMH Products

Product Documents for MIS/AMH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MIS/AMH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MIS/AMH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MIS/AMH Antibody - BSA Free and earn rewards!

Have you used MIS/AMH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MIS/AMH Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are working on a Sandwich ELISA platform for AMH assay. We have the following queries regarding the AMH antibodies: 1. Do you recommend any pairs of the antibodies for Sandwich Elisa platform for Human AMH protein detection? 2. Were the antibodies raised against recombinant protein or synthetic peptide or Native AMH protein? 3. What was the molecular weight of the AMH protein (140KDa or 22KDa) used to check the specificity of the antibodies?

    A: In regards to your sandwich ELISA inquiry, I was able to find a potential pair of antibodies that may work for your experiment (catalog numbers NBP1-70639 and NBP2-11800). Neither of these antibodies has been tested in ELISA or as a pair, so we cannot guarantee them in this application. The monoclonal antibody was raised against the human recombinant AMH protein. The polyclonal was raised against an AMH peptide. Since we do not epitope map the monoclonal, we cannot say for certain that it will not bind to a similar region as the polyclonal. If you would like to test these in ELISA, then I can recommend our Innovator's Reward program. The theoretical and observed molecular weight for this protein is 59kDa. You can find more information on UniProt about this protein: UniProt P03971.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...