Mitochondrial fission regulator 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84480

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mitochondrial fission regulator 1 Antibody - BSA Free

Mitochondrial fission regulator 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Mitochondrial fission regulator 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Mitochondrial fission regulator 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Mitochondrial fission regulator 1 Antibody - BSA Free Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.
Mitochondrial fission regulator 1 Antibody - BSA Free Western Blot: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Western Blot: Mitochondrial fission regulator 1 Antibody - BSA Free [NBP1-84480]

Analysis in human cell line U-2197.
Mitochondrial fission regulator 1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Mitochondrial fission regulator 1 Antibody [NBP1-84480]

Immunocytochemistry/ Immunofluorescence: Mitochondrial fission regulator 1 Antibody [NBP1-84480]

Staining of human cell line A-431 shows positivity in mitochondria.

Applications for Mitochondrial fission regulator 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mitochondrial fission regulator 1

The Mitochondrial fission regulator 1 gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene i

Alternate Names

Chondrocyte protein with a poly-proline region, CHPPRKIAA0009FAM54A2, mitochondrial fission regulator 1

Gene Symbol

MTFR1

Additional Mitochondrial fission regulator 1 Products

Product Documents for Mitochondrial fission regulator 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mitochondrial fission regulator 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mitochondrial fission regulator 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mitochondrial fission regulator 1 Antibody - BSA Free and earn rewards!

Have you used Mitochondrial fission regulator 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...