mitochondrial ribosomal protein L35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92119

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all mitochondrial ribosomal protein L35 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for mitochondrial ribosomal protein L35 Antibody - BSA Free

Immunohistochemistry-Paraffin: mitochondrial ribosomal protein L35 Antibody [NBP1-92119]

Immunohistochemistry-Paraffin: mitochondrial ribosomal protein L35 Antibody [NBP1-92119]

Immunohistochemistry-Paraffin: mitochondrial ribosomal protein L35 Antibody [NBP1-92119] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
mitochondrial ribosomal protein L35 Antibody - BSA Free Immunohistochemistry: mitochondrial ribosomal protein L35 Antibody - BSA Free [NBP1-92119]

Immunohistochemistry: mitochondrial ribosomal protein L35 Antibody - BSA Free [NBP1-92119]

Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Applications for mitochondrial ribosomal protein L35 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: mitochondrial ribosomal protein L35

MRPL35, also known as 39 S ribosomal protein L35, mitochondrial, consists of a 21.5 kDa and a 19.2 kDa and is utilized in the 39S ribosomal subunit for protein synthesis. There is no information regarding research involving the protein or pathways that the protein interacts in.

Alternate Names

L35mt, mitochondrial ribosomal protein L35, MRP-L35,39S ribosomal protein L35, mitochondrial

Gene Symbol

MRPL35

Additional mitochondrial ribosomal protein L35 Products

Product Documents for mitochondrial ribosomal protein L35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for mitochondrial ribosomal protein L35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mitochondrial ribosomal protein L35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mitochondrial ribosomal protein L35 Antibody - BSA Free and earn rewards!

Have you used mitochondrial ribosomal protein L35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies