MNF1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-03480
![Western Blot: MNF1 AntibodyBSA Free [NBP3-03480]](https://resources.rndsystems.com/images/products/MNF1-Antibody-Western-Blot-NBP3-03480-img0004.jpg "Western Blot: MNF1 AntibodyBSA Free [NBP3-03480]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human MNF1 (NP_115716.1). EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for MNF1 Antibody - BSA Free
Western Blot: MNF1 AntibodyBSA Free [NBP3-03480]
Western Blot: MNF1 Antibody [NBP3-03480] - Analysis of extracts of various cell lines, using MNF1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic![Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]](https://resources.rndsystems.com/images/products/MNF1-Antibody-Immunohistochemistry-Paraffin-NBP3-03480-img0003.jpg "Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]")
Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]
Immunohistochemistry-Paraffin: MNF1 Antibody [NBP3-03480] - Paraffin-embedded mouse heart using MNF1 antibody at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]](https://resources.rndsystems.com/images/products/MNF1-Antibody-Immunohistochemistry-Paraffin-NBP3-03480-img0001.jpg "Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]")
Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]
Immunohistochemistry-Paraffin: MNF1 Antibody [NBP3-03480] - Paraffin-embedded rat heart using MNF1 antibody at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]](https://resources.rndsystems.com/images/products/MNF1-Antibody-Immunohistochemistry-Paraffin-NBP3-03480-img0002.jpg "Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]")
Immunohistochemistry-Paraffin: MNF1 Antibody - BSA Free [NBP3-03480]
Immunohistochemistry-Paraffin: MNF1 Antibody [NBP3-03480] - Paraffin-embedded rat spleen using MNF1 antibody at dilution of 1:100 (40x lens).Applications for MNF1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: MNF1
Alternate Names
bA6B20.2, breast cancer associated protein SGA-81M, Breast cancer-associated protein SGA-81M, C6orf125, Cbp6, chromosome 6 open reading frame 125, hypothetical protein LOC84300, M19, MGC14833, mitochondrial nucleoid factor 1, MNF1
Gene Symbol
UQCC2
Additional MNF1 Products
Product Documents for MNF1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MNF1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for MNF1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for MNF1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MNF1 Antibody - BSA Free and earn rewards!
Have you used MNF1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...