Moesin Antibody (6G0N7)

Novus Biologicals | Catalog # NBP3-16513

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6G0N7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MSN (P26038). KEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Moesin Antibody (6G0N7)

Western Blot: Moesin Antibody (6G0N7) [NBP3-16513]

Western Blot: Moesin Antibody (6G0N7) [NBP3-16513]

Western Blot: Moesin Antibody (6G0N7) [NBP3-16513] - Western blot analysis of extracts of various cell lines, using Moesin Rabbit mAb (NBP3-16513) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513]

Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513]

Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513] - Immunohistochemistry of paraffin-embedded human colon using Moesin Rabbit mAb (NBP3-16513) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513]

Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513]

Immunohistochemistry-Paraffin: Moesin Antibody (6G0N7) [NBP3-16513] - Immunohistochemistry of paraffin-embedded rat spleen using Moesin Rabbit mAb (NBP3-16513) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Moesin Antibody (6G0N7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Moesin

Moesin (membrane-organizing extension spike protein) has previously been characterized as a possible receptor protein for heparan sulfate and also as a cytoskeletal linker protein that stabilizes cell surface microvilli, filopodia and lamellipodia. Data indicate that moesin is identical to the 77-kDa band that copurifies with ezrin in its isolation from human placenta (1). Members of the ezrin-radixin-moesin (ERM) family of membrane-cytoskeletal linking proteins have NH2- and COOH-terminal domains that associate with the plasma membrane and the actin cytoskeleton, respectively (2). It has been demonstrated that ezrin-radixin-moesin proteins are rapidly inactivated after antigen recognition through a Vav1-Rac1 pathway. The resulting disanchoring of the cortical actin cytoskeleton from the plasma membrane decreased cellular rigidity, leading to more efficient T cell-antigen-presenting cell conjugate formation (3).

Alternate Names

Membrane-organizing extension spike protein, moesin

Gene Symbol

MSN

Additional Moesin Products

Product Documents for Moesin Antibody (6G0N7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Moesin Antibody (6G0N7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Moesin Antibody (6G0N7)

There are currently no reviews for this product. Be the first to review Moesin Antibody (6G0N7) and earn rewards!

Have you used Moesin Antibody (6G0N7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Moesin Antibody (6G0N7)

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to use shRNA to inhibit Moesin expression. I have had people advise me that my initial MOI should be low as 'less is more' and 'a little goes a long way' in terms of siRNA. I was wondering if you could elaborate on this for me and explain why my initial MOI should be low.

    A: The reason for a low MOI is most likely because RNAi is a very strong and efficient technique. Wikipedia does a good job of explaining RNA interference. However, I would imagine that in a cell, there will be at most 1-2 copies of the gene mRNA present at any given time, unless you're dealing with a highly expressed protein such as Actin, where I would imagine silencing Actin would be lethal to the cell. I can imagine a few reasons to not use too much siRNA. First, it is expensive, so you don't want to waste it. Second, using too much would cause there to be a lot of non-translatable RNA present in the cell, which could trigger an immune response, as the presence of uncapped RNAs can indicate presence of a virus and one of the TLRs may respond to this.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...