MRPL23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30918

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRPL23 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPL23 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MRPL23 Antibody [NBP2-30918]

Immunocytochemistry/ Immunofluorescence: MRPL23 Antibody [NBP2-30918]

Immunocytochemistry/Immunofluorescence: MRPL23 Antibody [NBP2-30918] - Staining of human cell line PC-3 shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry-Paraffin: MRPL23 Antibody [NBP2-30918]

Immunohistochemistry-Paraffin: MRPL23 Antibody [NBP2-30918]

Immunohistochemistry-Paraffin: MRPL23 Antibody [NBP2-30918] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Applications for MRPL23 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL23

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within themitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. Theyhave an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes inbiochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.The gene is biallelically expressed, despite its location within a region of imprinted genes on chromosome 11.(provided by RefSeq)

Alternate Names

FLJ45387, L23MRPmitochondrial, mitochondrial ribosomal protein L23

Gene Symbol

MRPL23

UniProt

Q16540 (Human)

Additional MRPL23 Products

Product Documents for MRPL23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPL23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL23 Antibody - BSA Free and earn rewards!

Have you used MRPL23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies