MRPS12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13620

Novus Biologicals
Discontinued Product
NBP2-13620 has been discontinued. View all MRPS12 products.

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS12 Antibody - BSA Free

MRPS12 Antibody - BSA Free Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
MRPS12 Antibody - BSA Free Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
MRPS12 Antibody - BSA Free Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.
MRPS12 Antibody - BSA Free Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Immunohistochemistry: MRPS12 Antibody - BSA Free [NBP2-13620]

Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Applications for MRPS12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS12

MRPS12, also known as Mitochondrial Ribosomal Protein S12, consists of a 138 amino acid isoform that is 15 kDa, and is involved in the synthesis of proteins within the mitochondria, though its specific purpose is unknown. MRPS12 is currently being used in research with several diseases and disorders, such as autosomal dominant nonsyndromic deafness, esophageal carcinoma, mycobacterium tuberculosis, esophagitis, pneumonia, carcinoma, malaria, and sensorineural hearing loss, to determine its relationship with each condition. MRPS12 interacts with SPINK7, C14orf1, UNC119, CRMP1, and LRIF1 during the process of translation.(provided by RefSeq)

Alternate Names

28S ribosomal protein S12, mitochondrial, mitochondrial ribosomal protein S12, MPR-S12, MRP-S12, MT-RPS12, ribosomal protein, mitochondrial, S12, RPMS12, RPS12, RPSM12S12mt

Gene Symbol

MRPS12

Additional MRPS12 Products

Product Documents for MRPS12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS12 Antibody - BSA Free and earn rewards!

Have you used MRPS12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...