MTUS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60099

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MTUS1 Antibody - BSA Free

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: MTUS1 Antibody [NBP1-60099]

Immunohistochemistry: MTUS1 Antibody [NBP1-60099]

Immunohistochemistry: MTUS1 Antibody [NBP1-60099] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099]

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Applications for MTUS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTUS1

MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Alternate Names

Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1

Gene Symbol

MTUS1

UniProt

Additional MTUS1 Products

Product Documents for MTUS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTUS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTUS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTUS1 Antibody - BSA Free and earn rewards!

Have you used MTUS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...