NAP1L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81162

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NAP1L1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NAP1L1 Antibody - BSA Free

Western Blot: NAP1L1 Antibody [NBP1-81162]

Western Blot: NAP1L1 Antibody [NBP1-81162]

Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Western Blot: NAP1L1 Antibody [NBP1-81162]

Western Blot: NAP1L1 Antibody [NBP1-81162]

Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human fallopian tube shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162]

Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes as expected.

Applications for NAP1L1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAP1L1

NAP1L1 encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing of this gene results in several transcript variants; however, not all have been fully described. [provided by RefSeq]

Alternate Names

hNRP, HSP22-like protein interacting protein, MGC23410, MGC8688, NAP1, NAP-1 related protein, NAP1LFLJ16112, NRPNAP-1-related protein, nucleosome assembly protein 1-like 1

Entrez Gene IDs

4673 (Human)

Gene Symbol

NAP1L1

UniProt

P55209 (Human)

Additional NAP1L1 Products

Product Documents for NAP1L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NAP1L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NAP1L1 Antibody - BSA Free

Customer Reviews for NAP1L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NAP1L1 Antibody - BSA Free and earn rewards!

Have you used NAP1L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies