Nav1.5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86725

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Nav1.5. Peptide sequence: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nav1.5 Antibody - BSA Free

Western Blot: Nav1.5 Antibody [NBP2-86725]

Western Blot: Nav1.5 Antibody [NBP2-86725]

Western Blot: Nav1.5 Antibody [NBP2-86725] - WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Muscle
Immunohistochemistry-Paraffin: Nav1.5 Antibody [NBP2-86725]

Immunohistochemistry-Paraffin: Nav1.5 Antibody [NBP2-86725]

Immunohistochemistry-Paraffin: Nav1.5 Antibody [NBP2-86725] - Rabbit Anti-SCN5A Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Western Blot: Nav1.5 Antibody [NBP2-86725]

Western Blot: Nav1.5 Antibody [NBP2-86725]

Western Blot: Nav1.5 Antibody [NBP2-86725] - Host: Rabbit. Target Name: SCN5A. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Applications for Nav1.5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nav1.5

Nav1.5 is encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform. This antibody is expected to recognise both reported isoforms (NP_000326 and NP_932173).

Long Name

Sodium channel protein type 5 subunit alpha

Alternate Names

SCN5A

Gene Symbol

SCN5A

Additional Nav1.5 Products

Product Documents for Nav1.5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nav1.5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nav1.5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nav1.5 Antibody - BSA Free and earn rewards!

Have you used Nav1.5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...