NFAT5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49612

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFAT5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NFAT5 Antibody [NBP2-49612]

Immunocytochemistry/ Immunofluorescence: NFAT5 Antibody [NBP2-49612]

Immunocytochemistry/Immunofluorescence: NFAT5 Antibody [NBP2-49612] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus.

staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.

staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human kidney shows moderate nuclear positivity in cells in proximal tubules.

Staining of human kidney shows moderate nuclear positivity in cells in proximal tubules.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
NFAT5 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: NFAT5 Antibody - BSA Free [NBP2-49612]

Chromatin Immunoprecipitation-exo-Seq: NFAT5 Antibody - BSA Free [NBP2-49612]

ChIP-Exo-Seq composite graph for Anti-NFAT5 (NBP2-49612) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for NFAT5 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFAT5

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1 (also known as NFATp or NFATc2), NFAT2 (NFATc or NFATc1), NFAT3, and NFAT4 (NFATx or NFATc3). These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Alternate Names

EC 3.6.1, EC 3.6.3.14, KIAA0827glutamine rich protein H65, NF-AT5NFAT-like protein 1, NFATL1, NFATZ, nuclear factor of activated T-cells 5, tonicity-responsive, OREBP, osmotic response element-binding protein, T-cell transcription factor NFAT5, TonE-binding protein, TonEBP, TONEBPnuclear factor of activated T-cells 5, Tonicity-responsive enhancer-binding protein

Gene Symbol

NFAT5

Additional NFAT5 Products

Product Documents for NFAT5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFAT5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFAT5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFAT5 Antibody - BSA Free and earn rewards!

Have you used NFAT5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...