NFkB p100/p52 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87904

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFkB p100/p52. Peptide sequence: APETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NFkB p100/p52 Antibody - BSA Free

Western Blot: NFkB p100/p52 Antibody [NBP2-87904]

Western Blot: NFkB p100/p52 Antibody [NBP2-87904]

Western Blot: NFkB p100/p52 Antibody [NBP2-87904] - Host: Rabbit. Target Name: NFKB2. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-87904]

Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-87904]

Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-87904] - Rabbit Anti-NFKB2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue. Observed Staining: Cytoplasm. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

Applications for NFkB p100/p52 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFkB p100/p52

The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.

Alternate Names

DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52

Gene Symbol

NFKB2

Additional NFkB p100/p52 Products

Product Documents for NFkB p100/p52 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFkB p100/p52 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFkB p100/p52 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFkB p100/p52 Antibody - BSA Free and earn rewards!

Have you used NFkB p100/p52 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...