NHE3/SLC9A3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82574
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0023.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human, Mouse, Porcine
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC, SDS-Page
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for NHE3/SLC9A3 Antibody - BSA Free
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0025.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82574 (A) shows similar protein distribution across tissues to independent antibody NBP1-82575 (B).![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0026.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0024.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0029.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0027.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human kidney shows weak positivity in apical membrane in cells in tubules.![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]](https://resources.rndsystems.com/images/products/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0028.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]")
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human liver shows no membranous positivity in hepatocytes as expected.Applications for NHE3/SLC9A3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NHE3/SLC9A3
Long Name
Sodium/Hydrogen Exchanger 3
Alternate Names
SLC9A3
Gene Symbol
SLC9A3
Additional NHE3/SLC9A3 Products
Product Documents for NHE3/SLC9A3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NHE3/SLC9A3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for NHE3/SLC9A3 Antibody - BSA Free
Powered by Bioz
Customer Reviews for NHE3/SLC9A3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NHE3/SLC9A3 Antibody - BSA Free and earn rewards!
Have you used NHE3/SLC9A3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for NHE3/SLC9A3 Antibody - BSA Free
Showing
1
-
1 的
1 FAQ
Showing All
-
Q: The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa. I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?
A: Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it.
Loading...