NIR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34132

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NIR2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NIR2 Antibody - BSA Free

Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132] - TEST
Immunocytochemistry/ Immunofluorescence: NIR2 Antibody [NBP2-34132]

Immunocytochemistry/ Immunofluorescence: NIR2 Antibody [NBP2-34132]

Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-34132] - Staining of human cell line A549 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132]

Western Blot: NIR2 Antibody [NBP2-34132] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132]

Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Applications for NIR2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIR2

NIR2 belongs to a family of proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein. Nir2, a human homolog of Drosophila melanogaster retinal degeneration B protein, is essential for cytokinesis. A specific Thr residue in the Nir2 PI-transfer domain provides a regulatory site for targeting to lipid droplets. This may affect intracellular lipid trafficking and distribution & explain the dominant effect of the RdgB-T59E mutant on retinal degeneration.

Alternate Names

DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1

Gene Symbol

PITPNM1

UniProt

O00562 (Human)

Additional NIR2 Products

Product Documents for NIR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NIR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NIR2 Antibody - BSA Free

Customer Reviews for NIR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIR2 Antibody - BSA Free and earn rewards!

Have you used NIR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies