NMES1 Antibody

Novus Biologicals | Catalog # NBP2-31996

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG
View all NMES1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NMES1 Antibody

NMES1 Antibody Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Analysis in human rectum and liver. Corresponding C15orf48 RNA-seq data are presented for the same tissues.
NMES1 Antibody Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Staining of human liver shows no positivity in hepatocytes as expected.
NMES1 Antibody Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
NMES1 Antibody Immunohistochemistry-Paraffin: TCL1A Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: TCL1A Antibody [NBP2-31996]

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
NMES1 Antibody Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Staining of human colon shows strong cytoplasmic positivity in glandular cells.
NMES1 Antibody Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Immunohistochemistry-Paraffin: NMES1 Antibody [NBP2-31996]

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Applications for NMES1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMES1

C15orf48 was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified. Transcript Variant: This variant (2) contains an additional segment of 5' UTR sequence when compared to variant 1. Both variants 1 and 2 encode the same protein.

Alternate Names

C15orf48, chromosome 15 open reading frame 48, FLJ22645, FOAP-11, MGC32925, NMES1, NMES1normal mucosa of esophagus specific 1, normal mucosa of esophagus-specific gene 1 protein, Protein FOAP-11

Gene Symbol

C15ORF48

UniProt

Q9C002 (Human)

Additional NMES1 Products

Product Documents for NMES1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NMES1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NMES1 Antibody

There are currently no reviews for this product. Be the first to review NMES1 Antibody and earn rewards!

Have you used NMES1 Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies