Nocturnin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87931

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Nocturnin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Nocturnin. Peptide sequence: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nocturnin Antibody - BSA Free

Immunohistochemistry-Paraffin: Nocturnin Antibody [NBP2-87931]

Immunohistochemistry-Paraffin: Nocturnin Antibody [NBP2-87931]

Immunohistochemistry-Paraffin: Nocturnin Antibody [NBP2-87931] - Rabbit Anti-CCRN4L antibody. Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Immunohistochemistry: Nocturnin Antibody [NBP2-87931]

Immunohistochemistry: Nocturnin Antibody [NBP2-87931]

Immunohistochemistry: Nocturnin Antibody [NBP2-87931] - Human Lung

Applications for Nocturnin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nocturnin

Nocturnin is encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector. [provided by RefSeq]

Alternate Names

CCR4 carbon catabolite repression 4-like (S. cerevisiae), CCR4 protein homolog, CCR4-like (carbon catabolite repression 4, S.cerevisiae), CCR4LMGC142060, CCR4MGC4120817, MGC142054, MGC78549, NOC, nocturnin

Gene Symbol

NOCT

Additional Nocturnin Products

Product Documents for Nocturnin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nocturnin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nocturnin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nocturnin Antibody - BSA Free and earn rewards!

Have you used Nocturnin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies