Notch-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57913

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Notch-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Notch-1 Antibody [NBP2-57913]

Immunocytochemistry/ Immunofluorescence: Notch-1 Antibody [NBP2-57913]

Immunocytochemistry/Immunofluorescence: Notch-1 Antibody [NBP2-57913] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Applications for Notch-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Notch-1

Notch is synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase (S1 cleavage) in the trans-golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved (S2 cleavage) by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called Notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin-dependent gamma-secretase (S3 cleavage) to release the intracellular domain (NICD) from the membrane which then translocates to the nucleus to activate transcription of downstream genes.

Alternate Names

Notch1, TAN1

Gene Symbol

NOTCH1

Additional Notch-1 Products

Product Documents for Notch-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Notch-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Notch-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Notch-1 Antibody - BSA Free and earn rewards!

Have you used Notch-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Notch-1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: Hello, does this product (NB300-251) only recognize the cleavage Notch1?

    A: This antibody with recognize full length Notch1 if it is in the mix, as well as the cleaved product.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies