NOXO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49663

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NOXO1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NOXO1 Antibody [NBP2-49663]

Immunohistochemistry-Paraffin: NOXO1 Antibody [NBP2-49663]

Immunohistochemistry-Paraffin: NOXO1 Antibody [NBP2-49663] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Applications for NOXO1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 2 using NBP2-49663 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOXO1

NOXO1 (Nox organizing protein 1) and NOXA1 (Nox Activating protein 1) are homologs of p47phox and p67phox. p47phox functions in phagocytes as an essential organizing protein mediating the binding of other regulatory proteins during activation of the phagocyte oxidase, and its translocation to the membrane is triggered upon cell activation by hyperphosphorylation, which relieves autoinhibition of SH3 and PX domains. NOXO1 lacks an auto inhibitory region and phosphorylation sites that are present in p47phox. Co-transfection of Nox1, NOXO1 and NOXA1 reconstitutes ROS (reactive oxygen species) generation in HEK 293 cells in the absence of cell stimulation. NOXO1 binds to the phosphatidylinositol (PtdIns) lipids PtdIns 3,5-P2, PtdIns 5-P and PtdIns 4-P. Unlike p47phox, which is located in the cytosol of resting cells and translocates to the plasma membrane where gp91phox is located, NOXO1 co-localizes with Nox1 in the membranes of resting cells. This localization of NOXO1 is dictated by its PX domain, since this domain but not the remainder of the molecule localizes to membranes.

Alternate Names

MGC20258, NADPH oxidase organizer 1, Nox organizer 1, Nox-organizing protein 1, P41NOX, P41NOXA, P41NOXB, P41NOXC, regulatory protein P41NOX, SH3 and PX domain-containing protein 5, SH3PXD5NADPH oxidase regulatory protein, SNX28

Gene Symbol

NOXO1

Additional NOXO1 Products

Product Documents for NOXO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOXO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOXO1 Antibody - BSA Free (1)

2 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
100%
1 Stars
0%

Have you used NOXO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • noxo1 protein expression in mouse lung homogenate
    Name: Anonymous
    Application: Simple Western
    Sample Tested: Lung tissue
    Species: Mouse
    Verified Customer | Posted 09/10/2025
    Noxo1 protein expression in mouse lung homogenates using JESS
    tested the noxo1 protein expression using JESS in mouse lung from mice exposed to smoke or room air
    NOXO1 Antibody - BSA Free NBP2-49663
    Bio-Techne Response
    This review reflects a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...