NXF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57260

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NXF5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NXF5 (nuclear RNA export factor 5) The peptide sequence was selected from the middle region of NXF5. Peptide sequence ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NXF5 Antibody - BSA Free

Western Blot: NXF5 Antibody [NBP1-57260]

Western Blot: NXF5 Antibody [NBP1-57260]

Western Blot: NXF5 Antibody [NBP1-57260] - Lanes: Lane 1 : 7ug HeLa cystosolic extract Lane 2: 7ug HeLa nuclear extract Primary, Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF5.
Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260]

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260]

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: NXF5 Antibody [NBP1-57260]

Western Blot: NXF5 Antibody [NBP1-57260]

Western Blot: NXF5 Antibody [NBP1-57260] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260]

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260]

Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for NXF5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NXF5

NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.

Alternate Names

nuclear RNA export factor 5, TAPL1, TAPL-1, TAP-like protein 1

Gene Symbol

NXF5

UniProt

Q9H1B4 (Human)

Additional NXF5 Products

Product Documents for NXF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NXF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NXF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NXF5 Antibody - BSA Free and earn rewards!

Have you used NXF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies