OSTM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81829

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (89%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OSTM1 Antibody - BSA Free

Western Blot: OSTM1 Antibody [NBP1-81829]

Western Blot: OSTM1 Antibody [NBP1-81829]

Western Blot: OSTM1 Antibody [NBP1-81829] - Analysis in control (vector only transfected HEK293T lysate) and OSTM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OSTM1 Antibody [NBP1-81829]

Immunohistochemistry-Paraffin: OSTM1 Antibody [NBP1-81829]

Immunohistochemistry-Paraffin: OSTM1 Antibody [NBP1-81829] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Applications for OSTM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OSTM1

OSTM1 encodes a protein that may be involved in the degradation of G proteins via the ubiquitin-dependent proteasome pathway. The encoded protein binds to members of subfamily A of the regulator of the G-protein signaling (RGS) family through an N-terminal leucine-rich region. This protein also has a central RING finger-like domain and E3 ubiquitin ligase activity. This protein is highly conserved from flies to humans. Defects in this gene may cause the autosomal recessive, infantile malignant form of osteopetrosis. [provided by RefSeq]

Alternate Names

GIPN, GLGAIP-interacting protein N terminus, grey-lethal osteopetrosis, HSPC019, OPTB5, osteopetrosis associated transmembrane protein 1, osteopetrosis-associated transmembrane protein 1

Gene Symbol

OSTM1

Additional OSTM1 Products

Product Documents for OSTM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OSTM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for OSTM1 Antibody - BSA Free

Customer Reviews for OSTM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OSTM1 Antibody - BSA Free and earn rewards!

Have you used OSTM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OSTM1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: Does the OSTM1 antibody (NBP1-81829) work on murine tissues or proteins in western blot and immunohistochemistry (frozen sections)?

    A:

    Our OSTM1 antibody (NBP1-81829) has been validated in Human samples for WB/IHC-P applications only. There is a considerable similarity in the immunogen sequence used for this product when compared the same to the OSTM1 sequence of mouse protein, so that there is a pretty good chance of cross-reactivity. Therefore, you may optimize the best suitable conditions for the assay from your testing, and we would be more than happy to provide you our troubleshooting/technical feedback if you come up with any problems in generating your desired outcome. If you decide to test OSTM1 (NBP1-81829) in Mouse/IHC-Fr, and share your results/review feedback with us, please consider our Innovator's Reward program.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...