p120-catenin Antibody (5N7Z0)

Novus Biologicals | Catalog # NBP3-15375

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5N7Z0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 869-968 of human p120-catenin (O60716). TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p120-catenin Antibody (5N7Z0)

Western Blot: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Western Blot: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Western Blot: p120-catenin Antibody (5N7Z0) [NBP3-15375] - Western blot analysis of extracts of various cell lines, using p120-catenin Rabbit mAb (NBP3-15375) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Immunohistochemistry-Paraffin: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Immunohistochemistry-Paraffin: p120-catenin Antibody (5N7Z0) [NBP3-15375] - Immunohistochemistry of paraffin-embedded human esophageal using p120-catenin Rabbit mAb (NBP3-15375) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Immunoprecipitation: p120-catenin Antibody (5N7Z0) [NBP3-15375]

Immunoprecipitation: p120-catenin Antibody (5N7Z0) [NBP3-15375] - Immunoprecipitation analysis of 600ug extracts of Mouse testis cells using 3ug p120-catenin antibody (NBP3-15375). Western blot was performed from the immunoprecipitate using p120-catenin antibody (NBP3-15375) at a dilition of 1:1000.
p120-catenin Antibody (5N7Z0)

Immunohistochemistry: p120-catenin Antibody (5N7Z0) [p120-catenin] -

Immunohistochemistry: p120-catenin Antibody (5N7Z0) [p120-catenin] - Immunohistochemistry analysis of paraffin-embedded Human breast using p120-catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
p120-catenin Antibody (5N7Z0)

Immunohistochemistry: p120-catenin Antibody (5N7Z0) [p120-catenin] -

Immunohistochemistry: p120-catenin Antibody (5N7Z0) [p120-catenin] - Immunohistochemistry analysis of paraffin-embedded Human placenta using p120-catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for p120-catenin Antibody (5N7Z0)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: p120-catenin

The alpha, beta, delta, and gamma -catenins are proteins that bind to the highly conserved, intracellular cytoplasmic tail of E-cadherin. Together, the catenin/cadherin complexes play an important role mediating cellular adhesion. alpha-catenin, a 102 kDa protein, interacts with E-cadherin associated protein, and also associates with other members of the cadherin family, such as N-cadherin and P-cadherin. The 92 kDa beta-catenin associates with the cytoplasmic portion of E-cadherin, which is necessary for the function of E-cadherin as an adhesion molecule. beta-catenin also complexes with the tumor suppressor protein APC. delta-catenin interacts with Presenilin 1 and is expressed in the brain. The gene encoding delta-catenin maps to human chromosome 5p15.2. A hemizygous loss of the gene encoding delta-catenin leads to the mental retardation associated with Cri-du-Chat syndrome. gamma-catenin, also known as plakoglobin, is an 80-88 kDa protein that binds alpha-catenin and N-cadherin. In addition, the transmembrane phosphatase PTPm associates with catenin/cadherin complexes and may regulate complex signaling.

Alternate Names

Cadherin-associated Src substrate, CAS, catenin (cadherin-associated protein), delta 1, catenin delta-1, CTNND, KIAA0384P120CAS, p120, p120 catenin, p120(cas), p120(CTN), p120cas, p120ctn

Gene Symbol

CTNND1

Additional p120-catenin Products

Product Documents for p120-catenin Antibody (5N7Z0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p120-catenin Antibody (5N7Z0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p120-catenin Antibody (5N7Z0)

There are currently no reviews for this product. Be the first to review p120-catenin Antibody (5N7Z0) and earn rewards!

Have you used p120-catenin Antibody (5N7Z0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...