PAFAH1B3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86305

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAFAH1B3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAFAH1B3 Antibody [NBP1-86305]

Immunocytochemistry/ Immunofluorescence: PAFAH1B3 Antibody [NBP1-86305]

Immunocytochemistry/Immunofluorescence: PAFAH1B3 Antibody [NBP1-86305] - Staining of human cell line A549 shows localization to intermediate filaments. Antibody staining is shown in green.
PAFAH1B3 Antibody - BSA Free Western Blot: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Western Blot: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Analysis in control (vector only transfected HEK293T lysate) and PAFAH1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
PAFAH1B3 Antibody - BSA Free Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Staining of human lymph node shows weak cytoplasmic and membranous positivity in lymphoid cells.
PAFAH1B3 Antibody - BSA Free Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Staining of human kidney shows moderate membranous positivity in cells in distal tubules.
PAFAH1B3 Antibody - BSA Free Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
PAFAH1B3 Antibody - BSA Free Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Immunohistochemistry-Paraffin: PAFAH1B3 Antibody - BSA Free [NBP1-86305]

Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Applications for PAFAH1B3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAFAH1B3

The PAFAH1B3 gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consis

Alternate Names

EC 3.1.1.47, FLJ44990, PAF acetylhydrolase 29 kDa subunit, PAF-AH 29 kDa subunit, PAFAH subunit gamma, PAF-AH subunit gamma, PAF-AH1b alpha 1 subunit, PAFAHG, platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa), platelet-activating factor acetylhydrolase IB subunit gamma, platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD), platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa)

Gene Symbol

PAFAH1B3

Additional PAFAH1B3 Products

Product Documents for PAFAH1B3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAFAH1B3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAFAH1B3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAFAH1B3 Antibody - BSA Free and earn rewards!

Have you used PAFAH1B3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...