PARD6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38487

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARD6A Antibody - BSA Free

Western Blot: PARD6A Antibody [NBP2-38487]

Western Blot: PARD6A Antibody [NBP2-38487]

Western Blot: PARD6A Antibody [NBP2-38487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human kidney shows strong membranous positivity
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487]

Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human liver shows no positivity in hepatocytes as expected.
PARD6A Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PARD6A Antibody [NBP2-38487]

Immunocytochemistry/ Immunofluorescence: PARD6A Antibody [NBP2-38487]

Staining of human cell line MCF7 shows localization to actin filaments & cell junctions.

Applications for PARD6A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARD6A

his gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Alternate Names

PAR-6, PAR-6 alpha, par-6 partitioning defective 6 homolog alpha (C. elegans), PAR6A, PAR6alpha, PAR-6Apar-6 (partitioning defective 6, C.elegans) homolog alpha, PAR6C, partitioning defective 6 homolog alpha, partitioning defective-6 homolog alpha, partitioning-defective protein 6, Tax interaction protein 40, TAX40, Tax-interacting protein 40, TIP-40PAR6

Gene Symbol

PARD6A

UniProt

Additional PARD6A Products

Product Documents for PARD6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARD6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARD6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PARD6A Antibody - BSA Free and earn rewards!

Have you used PARD6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...