PCBP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83241

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25411354).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCBP2 Antibody - BSA Free

PCBP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
PCBP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
PCBP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
PCBP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Immunohistochemistry-Paraffin: PCBP2 Antibody - BSA Free [NBP1-83241]

Staining of human testis shows strong cytoplasmic and nulcear positivity in cells in seminiferous ducts.
PCBP2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PCBP2 Antibody [NBP1-83241]

Immunocytochemistry/ Immunofluorescence: PCBP2 Antibody [NBP1-83241]

Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Applications for PCBP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCBP2

PCBP2 is encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only three have been characterized to date.

Alternate Names

alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, heterogenous nuclear ribonucleoprotein E2, hnRNP E2, hnRNP-E2, HNRPE2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2

Gene Symbol

PCBP2

Additional PCBP2 Products

Product Documents for PCBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PCBP2 Antibody - BSA Free

Customer Reviews for PCBP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCBP2 Antibody - BSA Free and earn rewards!

Have you used PCBP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...