Pit1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85477

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Pit1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Pit1. Peptide sequence: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Pit1 Antibody - BSA Free

Western Blot: Pit1 Antibody [NBP2-85477]

Western Blot: Pit1 Antibody [NBP2-85477]

Western Blot: Pit1 Antibody [NBP2-85477] - WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-85477]

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-85477]

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP2-85477] - Rabbit Anti-POU1F1 Antibody. Paraffin Embedded Tissue: Human pituitary. Observed staining: Nuclear. Primary Antibody Dilution: 1:600. Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT. Chromogen: DAB. Counterstaining: Hematoxylin.
Western Blot: Pit1 Antibody [NBP2-85477]

Western Blot: Pit1 Antibody [NBP2-85477]

Western Blot: Pit1 Antibody [NBP2-85477] - Host: Rabbit. Target Name: POU1F1. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml

Applications for Pit1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pit1

The Pit1 gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combin

Alternate Names

CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a

Gene Symbol

POU1F1

Additional Pit1 Products

Product Documents for Pit1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pit1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pit1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pit1 Antibody - BSA Free and earn rewards!

Have you used Pit1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies