PKC iota Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84959
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PKC iota Antibody - BSA Free
Western Blot: PKC iota Antibody [NBP1-84959]
Western Blot: PKC iota Antibody [NBP1-84959] - Analysis in human cell line A-431.Immunocytochemistry/ Immunofluorescence: PKC iota Antibody [NBP1-84959]
Immunocytochemistry/Immunofluorescence: PKC iota Antibody [NBP1-84959] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959]
Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959]
Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959] - Staining of human fallopian tube shows strong membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959]
Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959] - Staining of human rectum shows moderate membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959]
Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.Western Blot: PKC iota Antibody - BSA Free [NBP1-84959] -
Identification of mutations and protein expression in modifier strains.A. Fundus photodocumentation of B6 rd8 and Tvrm266 mice at 10 weeks of age, and Tvrm323 mice at 3 months of age. Right (OD) and left (OS) eyes of a single mouse are shown. The lower portion of each image corresponds to the inferior retina based on the position of the mouse head relative to the camera during imaging. B. Sequence and amino acid translation of the mutant alleles. The DNA sequence corresponds to a portion of the forward strand of each gene, numbered as in the mRNA. Mutations are indicated in bold above the sequence. The predicted amino acid sequence is given beneath the DNA sequence using the single-letter code and the predicted translational effect of the mutation is indicated in bold below. C. Enhanced chemiluminescence western analysis. Posterior eyecup lysates from B6 control and modifier strains (n = 4) were electrophoresed and transferred to nitrocellulose. Tvrm266 blots were probed with ARHGEF12 antibody and Tvrm323 blots with PRKCI antibody. After imaging, blots were probed with GAPDH antibody and reimaged to control for protein recovery and loading. Molecular weights of protein standards are indicated in kDa. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35675330), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PKC iota Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 µg/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PKC iota
Long Name
Protein kinase C iota type
Alternate Names
aPKC-lambda/iota, DXS1179E, nPKC-iota, PRKC-lambda/iota
Gene Symbol
PRKCI
Additional PKC iota Products
Product Documents for PKC iota Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PKC iota Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PKC iota Antibody - BSA Free
Customer Reviews for PKC iota Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PKC iota Antibody - BSA Free and earn rewards!
Have you used PKC iota Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...