Plastin L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88057

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Predicted:

Mouse (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Plastin L Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Plastin L Antibody [NBP1-88057]

Immunocytochemistry/ Immunofluorescence: Plastin L Antibody [NBP1-88057]

Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP1-88057] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.
Plastin L Antibody

Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] -

Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] -Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.
Plastin L Antibody - BSA Free Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Plastin L Antibody - BSA Free Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.
Plastin L Antibody - BSA Free Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Immunohistochemistry-Paraffin: Plastin L Antibody - BSA Free [NBP1-88057]

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Plastin L Antibody - BSA Free Western Blot: Plastin L Antibody - BSA Free [NBP1-88057]

Western Blot: Plastin L Antibody - BSA Free [NBP1-88057]

Analysis in human cell line HEK 293 and human cell line HeLa.
Plastin L Antibody - BSA Free Western Blot: Plastin L Antibody - BSA Free [NBP1-88057]

Western Blot: Plastin L Antibody - BSA Free [NBP1-88057]

Analysis in rat cell line NBT-II.

Applications for Plastin L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Plastin L

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. (provided by RefSeq)

Alternate Names

CP64, DKFZp781A23186, FLJ25423, FLJ26114, FLJ39956, LC64PPLS2bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin)), LCP-1, LPL, L-plastin, L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P), Lymphocyte cytosolic protein 1, lymphocyte cytosolic protein 1 (L-plastin), Lymphocyte cytosolic protein-1 (plasmin), plastin 2, plastin-2

Gene Symbol

LCP1

Additional Plastin L Products

Product Documents for Plastin L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Plastin L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Plastin L Antibody - BSA Free

Customer Reviews for Plastin L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Plastin L Antibody - BSA Free and earn rewards!

Have you used Plastin L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Plastin L Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: What is the concentration of lot# R10186?

    A: Lot number R10186 of our LCP1 antibody with catalogue number NBP1-88057 is provided at a concentration of 1mg/ml.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...