Procalcitonin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16983

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Procalcitonin Antibody - BSA Free

Western Blot: Procalcitonin Antibody [NBP3-16983]

Western Blot: Procalcitonin Antibody [NBP3-16983]

Western Blot: Procalcitonin Antibody [NBP3-16983] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: Procalcitonin Antibody [NBP3-16983]

Immunocytochemistry/ Immunofluorescence: Procalcitonin Antibody [NBP3-16983]

Immunocytochemistry/Immunofluorescence: Procalcitonin Antibody [NBP3-16983] - Analysis in human thyroid gland and duodenum tissues using Anti-CALCA antibody. Corresponding CALCA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983]

Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983]

Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983]

Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983]

Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983] - Staining of human thyroid gland shows high expression.

Applications for Procalcitonin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Procalcitonin

Procalcitonin (PCT) is a 116 amino acid residue peptide with molecular weight of about 13 kDa. PCT itself has no known hormonal activity. PCT belongs to a group of related proteins including calcitonin gene-related peptides I and II, amylin, adrenomodulin and calcitonin (CAPA peptide family). PCT, like other peptides of CAPA family, appears from the common precursor pre-procalcitonin consisting of 141 amino acids by removal of 25 amino acids from the N-terminus. PCT undergoes successive cleavages to form three molecules: N-terminal fragment (55 a.a.), calcitonin (32 a.a.) and katacalcin (21 a.a.). Under normal metabolic conditions, PCT is only present in the C cells of the thyroid gland. In bacterial infection and sepsis, however, intact PCT is found in the blood and, more importantly, its level is related to the severity of bacterial sepsis. Today, PCT is considered to be one of the earliest and most specific markers of sepsis.

Alternate Names

CALC1, CALCA, Calcitonin 1, calcitonin gene-related peptide 1, CGRP, Katacalcin

Gene Symbol

CALCA

Additional Procalcitonin Products

Product Documents for Procalcitonin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Procalcitonin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Procalcitonin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Procalcitonin Antibody - BSA Free and earn rewards!

Have you used Procalcitonin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...