Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33585

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Protein Kinase A regulatory subunit I alpha Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Simple Western: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585]

Simple Western: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Lane view shows a specific band for Protein Kinase A regulatory subunit I alpha using 200 ug/mL of Sk-Mel-28 cell lysate and 4 ug/mL antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 54 kDa. Image from an internal validation.

Applications for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Sk-Mel-28 and h. Liver lysates, separated by Size, antibody dilution of 1:25, apparent MW was 55 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protein Kinase A regulatory subunit I alpha

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Long Name

cAMP-dependent protein kinase type I-alpha regulatory subunit

Alternate Names

PRKAR1, PRKAR1A, TSE1

Gene Symbol

PRKAR1A

UniProt

P10644 (Human)

Additional Protein Kinase A regulatory subunit I alpha Products

Product Documents for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protein Kinase A regulatory subunit I alpha Antibody - BSA Free and earn rewards!

Have you used Protein Kinase A regulatory subunit I alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies