PTHLH/PTHrP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59322

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTHLH/PTHrP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PTHLH (parathyroid hormone-like hormone) The peptide sequence was selected from the middle region of PTHLH. Peptide sequence YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PTHLH/PTHrP Antibody - BSA Free

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322]

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322]

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322]

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322]

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322]

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322]

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322]

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322]

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
PTHLH/PTHrP Antibody

Western Blot: Rabbit Polyclonal PTHLH/PTHrP Antibody [NBP1-59322] -

Western Blot: Rabbit Polyclonal PTHLH/PTHrP Antibody [NBP1-59322] - The expression level of PTHLH/PTHrP in several kinds of lung cancer cell lines and in lung cancer tissues. Image from a verified customer review.

Applications for PTHLH/PTHrP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-59322 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTHLH/PTHrP

PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Long Name

Parathyroid Hormone-like Hormone

Alternate Names

BDE2, HHM, Osteostatin, PTHRP

Gene Symbol

PTHLH

UniProt

P12272

Additional PTHLH/PTHrP Products

Product Documents for PTHLH/PTHrP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTHLH/PTHrP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PTHLH/PTHrP Antibody - BSA Free

Customer Reviews for PTHLH/PTHrP Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PTHLH/PTHrP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • PTHLH/PTHrP Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human lung cancer cell lines, Human lung cancer tissue samples and fibroblasts
    Species: Human
    Verified Customer | Posted 11/03/2023
    The expression level of PTHLH(PTHrP) in several kinds of lung cancer cell lines and in lung cancer tissues.
    PTHLH/PTHrP Antibody - BSA Free NBP1-59322

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies