Rab5a Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03360

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rab5a Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human RAB5A (NP_004153.2). MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rab5a Antibody - BSA Free

Rab5a Antibody - Azide and BSA Free

Western Blot: Rab5a Antibody - Azide and BSA Free [Rab5a] -

Western Blot: Rab5a Antibody - Azide and BSA Free [Rab5a] - Western blot analysis of various lysates, using Rab5a Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody [NBP3-03360] - Immunohistochemistry of paraffin-embedded rat spleen using [KO Validated] Rab5a Rabbit pAb (NBP3-03360) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody [NBP3-03360] - Immunohistochemistry of paraffin-embedded human liver cancer using [KO Validated] Rab5a Rabbit pAb (NBP3-03360) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody [NBP3-03360] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] Rab5a Rabbit pAb (NBP3-03360) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody - Azide and BSA Free [NBP3-03360]

Immunohistochemistry-Paraffin: Rab5a Antibody [NBP3-03360] - Immunohistochemistry of paraffin-embedded mouse spleen using [KO Validated] Rab5a Rabbit pAb (NBP3-03360) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Rab5a Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] -

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] - Immunofluorescence analysis of U-2 OS cells using Rab5a Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Rab5a Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] -

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] - Immunofluorescence analysis of C6 cells using Rab5a Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Rab5a Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] -

Immunocytochemistry/ Immunofluorescence: Rab5a Antibody - Azide and BSA Free [Rab5a] - Immunofluorescence analysis of NIH-3T3 cells using Rab5a Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Rab5a Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rab5a

Rab5 is a 24 kDa GTP-binding protein that regulates the fusion of plasma membrane -derived clathrin-coated vesicles with early endosomes, and homotypic fusion among early endosomes1. Localized to the cytoplasmic side of the plasma membrane, clathrin -coated vesicles and early endosomes, Rab5 appears to regulate vesicle fusion through a cycle of GDP/GTP e xchange and GTP hydrolysis. The different guanine nuc leotide binding states of Rab5 may affect its ability to associate or dissociate with membranes during endocytotic membrane traffic. The GTP-bound, or active, form of Rab5 associates with membrane s and regulates vesicle docking and fusion. Studies using a Rab5 mutant that hydrolyzed xanthosine 5 -triphosphate (XTP) indicated that nucleotide hydrolysis occurs even in the absence of membrane fusion. GTP hydrolysis by Rab5 may determine the frequency of membrane docking and fusion events.

Alternate Names

RAB5A, member RAS oncogene family, RAB5RAS-associated protein RAB5A, ras-related protein Rab-5A

Gene Symbol

RAB5A

Additional Rab5a Products

Product Documents for Rab5a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rab5a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Rab5a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab5a Antibody - BSA Free and earn rewards!

Have you used Rab5a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies