RASAL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82578

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RASAL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RASAL2 Antibody - BSA Free

Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: RASAL2 Antibody [NBP1-82578]

Immunohistochemistry-Paraffin: RASAL2 Antibody [NBP1-82578]

Immunohistochemistry-Paraffin: RASAL2 Antibody [NBP1-82578] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-460
Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578]

Western Blot: RASAL2 Antibody [NBP1-82578] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for RASAL2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASAL2

RASAL2 encodes a protein that contains the GAP-related domain (GRD), a characteristic domain of GTPase-activating proteins (GAPs). GAPs function as activators of Ras superfamily of small GTPases. The protein encoded by this gene is able to complement the defective RasGAP function in a yeast system. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Alternate Names

MGC129919, NGAP, ras GTPase-activating protein nGAP, Ras protein activator like 1, RAS protein activator like 2, RAS protein activator-like 2

Gene Symbol

RASAL2

Additional RASAL2 Products

Product Documents for RASAL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RASAL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASAL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RASAL2 Antibody - BSA Free and earn rewards!

Have you used RASAL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies