RBM25 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83418
![Immunocytochemistry/ Immunofluorescence: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/RBM25-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83418-img0008.jpg "Immunocytochemistry/ Immunofluorescence: RBM25 Antibody [NBP1-83418]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RBM25 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: RBM25 Antibody [NBP1-83418]
Immunocytochemistry/Immunofluorescence: RBM25 Antibody [NBP1-83418] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.![Simple Western: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/RBM25-Antibody-Simple-Western-NBP1-83418-img0006.jpg "Simple Western: RBM25 Antibody [NBP1-83418]")
Simple Western: RBM25 Antibody [NBP1-83418]
Simple Western: RBM25 Antibody [NBP1-83418] - Simple Western lane view shows a specific band for RBM25 in 0.2 mg/ml of MOLT-4 (left) and A431 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.![Simple Western: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/RBM25-Antibody-Simple-Western-NBP1-83418-img0007.jpg "Simple Western: RBM25 Antibody [NBP1-83418]")
Simple Western: RBM25 Antibody [NBP1-83418]
Simple Western: RBM25 Antibody [NBP1-83418] - Electropherogram image of the corresponding Simple Western lane view. RBM25 antibody was used at 1:25 dilution on MOLT-4 and A431 lysate(s) respectively.![RBM25 Antibody - BSA Free Western Blot: RBM25 Antibody - BSA Free [NBP1-83418]](https://resources.rndsystems.com/images/products/nbp1-83418_rabbit-polyclonal-rbm25-antibody-8420251775489.jpg "Western Blot: RBM25 Antibody - BSA Free [NBP1-83418]")
Western Blot: RBM25 Antibody - BSA Free [NBP1-83418]
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4
![RBM25 Antibody - BSA Free Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/nbp1-83418_-immunohistochemistry-paraffin-639173123547521336.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]")
Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.![RBM25 Antibody - BSA Free Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/nbp1-83418_-immunohistochemistry-paraffin-639173124878660935.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]")
Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]
Staining of human liver shows no positivity in hepatocytes as expected.![RBM25 Antibody - BSA Free Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/nbp1-83418_-immunohistochemistry-paraffin-639173125176334897.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]")
Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]
Staining of human placenta shows strong nuclear positivity in trophoblastic cells.![RBM25 Antibody - BSA Free Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]](https://resources.rndsystems.com/images/products/nbp1-83418_-immunohistochemistry-paraffin-639173132665156333.jpg "Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]")
Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418]
Staining of human duodenum shows strong nuclear positivity in glandular cells.Applications for RBM25 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:25
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 and A431 lysates, separated by Size, antibody dilution of 1:25, apparent MW was 141-144 kDa.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 and A431 lysates, separated by Size, antibody dilution of 1:25, apparent MW was 141-144 kDa.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RBM25
Alternate Names
Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-binding motif protein 25, RNA-binding protein 25, RNA-binding region (RNP1, RRM) containing 7, RNPC7, S164, Snu71, U1 small nuclear ribonucleoprotein 1SNRP homolog
Gene Symbol
RBM25
Additional RBM25 Products
Product Documents for RBM25 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RBM25 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RBM25 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RBM25 Antibody - BSA Free and earn rewards!
Have you used RBM25 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...