RCAN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86770

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human RCAN1. Peptide sequence: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RCAN1 Antibody - BSA Free

Western Blot: RCAN1 Antibody [NBP2-86770]

Western Blot: RCAN1 Antibody [NBP2-86770]

Western Blot: RCAN1 Antibody [NBP2-86770] - WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Placenta
Immunohistochemistry-Paraffin: RCAN1 Antibody [NBP2-86770]

Immunohistochemistry-Paraffin: RCAN1 Antibody [NBP2-86770]

Immunohistochemistry-Paraffin: RCAN1 Antibody [NBP2-86770] - Rabbit Anti-RCAN1 / DSCR1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Brain, cerebellum. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600.

Applications for RCAN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RCAN1

RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. RCAN1 is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for RCAN1.

Alternate Names

Adapt78, calcipressin-1, calcium and oxidant-inducible mRNA, Down syndrome candidate region 1, Down syndrome critical region gene 1, Down syndrome critical region protein 1, DSC1, modulatory calcineurin-interacting protein 1, Myocyte-enriched calcineurin-interacting protein 1, near DSCR proline-rich protein, regulator of calcineurin 1CSP1DSCR1MCIP1RCN1

Gene Symbol

RCAN1

Additional RCAN1 Products

Product Documents for RCAN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RCAN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RCAN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RCAN1 Antibody - BSA Free and earn rewards!

Have you used RCAN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...