RGS17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80839

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RGS17 Antibody - BSA Free

Western Blot: RGS17 Antibody [NBP1-80839]

Western Blot: RGS17 Antibody [NBP1-80839]

Western Blot: RGS17 Antibody [NBP1-80839] - Analysis in control (vector only transfected HEK293T lysate) and RGS17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RGS17 Antibody [NBP1-80839]

Immunohistochemistry-Paraffin: RGS17 Antibody [NBP1-80839]

Immunohistochemistry-Paraffin: RGS17 Antibody [NBP1-80839] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts of testis.
RGS17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RGS17 Antibody - BSA Free [NBP1-80839] -

RGS17 tissue-specific knockout scheme and effect of cisplatin in RGS17 expression in whole-mount dissection. (A) Genomic organization of RGS17loxp and RGS17−/− alleles. Exon 2 was flanked with the loxP sequence, which was cleaved using Atoh-1CreEr to generate mice with specific RGS17−/− knockout in the hair cells. (B) The cochleae were harvested from wild-type RGS17+/+ and RGS17−/− mice. Whole-mount dissection for basal turn was immunolabeled with RGS17 antibody to validate RGS17 expression. The expression of RGS17 (green) was located in the outer and inner hair cells of wild-type mice. However, RGS17 was not detected in the outer and inner hair cells of knockout mice. (C) Schematic illustration of the experimental design that describes the dosage and route of administration of control or cisplatin (3.5 mg/kg) for two cycles; each cycle consists of a 4-day cisplatin administration followed by a 10-day recovery period. Mice were sacrificed at the end of the second cycle (D), and cochleae were collected and processed for whole-mount dissection. The basal turns of each cochlea were immunolabeled with RGS17 (green) and DAPI (blue). High levels of RGS17 immunolabeling were detected in the outer and inner hair cells of wild-type RGS17+/+ mice treated with cisplatin. Inducible hair cell-specific RGS17 knockdown (RGS17+/−) mice showed a slight increase of RGS17 immunolabeling in the outer and inner hair cells following cisplatin administration. However, a hair cell-specific knockout of RGS17 abolished the immunolabeling of RGS17 in both the outer and inner hair cells. Figures shown are representative of six independent animals per treatment group. Scale bar = 40 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40061942), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RGS17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RGS17 Antibody - BSA Free [NBP1-80839] -

RGS17 tissue-specific knockout scheme and effect of cisplatin in RGS17 expression in whole-mount dissection. (A) Genomic organization of RGS17loxp and RGS17−/− alleles. Exon 2 was flanked with the loxP sequence, which was cleaved using Atoh-1CreEr to generate mice with specific RGS17−/− knockout in the hair cells. (B) The cochleae were harvested from wild-type RGS17+/+ and RGS17−/− mice. Whole-mount dissection for basal turn was immunolabeled with RGS17 antibody to validate RGS17 expression. The expression of RGS17 (green) was located in the outer and inner hair cells of wild-type mice. However, RGS17 was not detected in the outer and inner hair cells of knockout mice. (C) Schematic illustration of the experimental design that describes the dosage and route of administration of control or cisplatin (3.5 mg/kg) for two cycles; each cycle consists of a 4-day cisplatin administration followed by a 10-day recovery period. Mice were sacrificed at the end of the second cycle (D), and cochleae were collected and processed for whole-mount dissection. The basal turns of each cochlea were immunolabeled with RGS17 (green) and DAPI (blue). High levels of RGS17 immunolabeling were detected in the outer and inner hair cells of wild-type RGS17+/+ mice treated with cisplatin. Inducible hair cell-specific RGS17 knockdown (RGS17+/−) mice showed a slight increase of RGS17 immunolabeling in the outer and inner hair cells following cisplatin administration. However, a hair cell-specific knockout of RGS17 abolished the immunolabeling of RGS17 in both the outer and inner hair cells. Figures shown are representative of six independent animals per treatment group. Scale bar = 40 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40061942), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RGS17 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS17

The RGS17 gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to

Alternate Names

hRGS17, regulator of G-protein signaling 17, regulator of G-protein signalling 17, RGS-17, RGSZ2

Entrez Gene IDs

26575 (Human)

Gene Symbol

RGS17

UniProt

Additional RGS17 Products

Product Documents for RGS17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGS17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RGS17 Antibody - BSA Free

Customer Reviews for RGS17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS17 Antibody - BSA Free and earn rewards!

Have you used RGS17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...