RHCE Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17923

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RHCE Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RHCE Antibody - BSA Free

Immunohistochemistry-Paraffin: RHCE Antibody [NBP3-17923]

Immunohistochemistry-Paraffin: RHCE Antibody [NBP3-17923]

Immunohistochemistry-Paraffin: RHCE Antibody [NBP3-17923] - Staining of human bone marrow shows strong positivity in hematopoietic cells.

Applications for RHCE Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHCE

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms. (provided by RefSeq)

Alternate Names

blood group Rh(CE) polypeptide, blood group RhCcEe antigen, CD240CE, CD240CE antigen, MGC103977, RH, Rh blood group antigen Evans, Rh blood group C antigen, Rh blood group, CcEe antigens, Rh polypeptide 1, Rh polypeptide I, RH30A, Rh4, RHC, RHCE blood group variant Crawford antigen Rh43, RHE, Rhesus blood group CE protein, Rhesus blood group E antigen, Rhesus blood group Rhce antigen, Rhesus blood group, CcEe antigens, Rhesus C/E antigens, Rhesus system C and E polypeptides, RhIVb(J), RhIXB, RhPI, RhVI, RhVIII, silenced Rh blood group CcEe antigen

Gene Symbol

RHCE

Additional RHCE Products

Product Documents for RHCE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RHCE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHCE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHCE Antibody - BSA Free and earn rewards!

Have you used RHCE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies