RHOT2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88982
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
Reactivity Notes
Human reactivity reported in scientific literature (PMID: 24671417).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RHOT2 Antibody - BSA Free
Western Blot: RHOT2 Antibody [NBP1-88982]
Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.Immunocytochemistry/ Immunofluorescence: RHOT2 Antibody [NBP1-88982]
Immunocytochemistry/Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982]
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Liver shows moderate granular cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982]
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982]
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982]
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.Simple Western: RHOT2 Antibody [NBP1-88982]
Simple Western: RHOT2 Antibody [NBP1-88982] - Simple Western lane view shows a specific band for RHOT2 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: RHOT2 Antibody [NBP1-88982]
Simple Western: RHOT2 Antibody [NBP1-88982] - Electropherogram image(s) of corresponding Simple Western lane view. RHOT2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).Applications for RHOT2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
WB, ICC/IF reported in the literature (PMID:24671417). ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 75 kDa
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 75 kDa
Reviewed Applications
Read 1 review rated 5 using NBP1-88982 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RHOT2
Alternate Names
ARHT2, C16orf39, chromosome 16 open reading frame 39, EC 3.6.5, EC 3.6.5.-, hMiro-2, MIRO-2mitochondrial Rho 2, mitochondrial Rho GTPase 2, Ras homolog gene family member T2, ras homolog gene family, member T2, RASL
Gene Symbol
RHOT2
Additional RHOT2 Products
Product Documents for RHOT2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RHOT2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RHOT2 Antibody - BSA Free
Customer Reviews for RHOT2 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used RHOT2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Tissue LysatesSpecies: HumanVerified Customer | Posted 04/11/2019Western blot analysis of meningioma tumour (whole) tumour lysates yielded strong/clear bands at the predicted molecular weight. highly recommended Ab
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...