RNF182 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82707
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Rat (99%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Cited:
Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:35458235).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RNF182 Antibody - BSA Free
Western Blot: RNF182 Antibody [NBP1-82707]
Western Blot: RNF182 Antibody [NBP1-82707] - Analysis in control (vector only transfected HEK293T lysate) and RNF182 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707]
Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -
Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -Staining of human spleen shows moderate membranous positivity in cells in white pulp.Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -
Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -
Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human liver shows no positivity in hepatocytes as expected.Western Blot: RNF182 Antibody - BSA Free [NBP1-82707] -
FR promotes the K48-linked ubiquitination of p65 by recruiting the E3 ubiquitin enzyme RNF182. Tenocytes were silenced with RNF182 siRNA (A), ING4 siRNA (B), or PPAR gamma siRNA (C) for 24 h and then treated with IL-1 beta (10 ng/mL) and FR (40 μM) for 24 h. Finally, the protein expression of p65 was detected by WB. (D) HEK293T cells were treated with RNF182 siRNA for 24 h, then transfected with HA-K48-Ub and Flag-p65 plasmids for 12 h, and next stimulated with 3-MA (5 mM) for 6 h, and finally treated with FR (40 μM) for 8 h. Cell lysates were collected for IP and WB detection. (E) Tenocytes were transfected with RNF182 siRNA for 24 h, then treated with 3-MA (5 mM) for 6 h, and finally treated with IL-1 beta (10 ng/mL) and FR (40 μM) for 24 h. Cell proteins were collected for IP. The expressions of p65 and K48-Ub in IP and WCL samples were detected by WB. (F) Flag-p65 and GFP-RNF182 plasmids were transfected into HEK293T cells for 24 h and then treated with FR (40 μM) for 8 h. Finally, WB was used to detect the protein of the Flag tag and GFP tag. (G) HEK293T cells were transfected with Flag-p65 and GFP-RNF182 plasmids for 24 h, then 3-MA (5 mM) was added for 6 h and then treated with FR (40 μM) for another 8 h. Finally, cell proteins were collected for IP, and proteins with Flag and GFP labels were detected by WB. (H) Tenocytes were pretreated with 3-MA (5 mM) for 6 h, followed by the addition of IL-1 beta (10 ng/mL) and FR (40 μM) for 24 h. Cell proteins were collected for IP. WB detected the protein expressions of p65 and RNF182 in IP and WCL samples. Data are expressed as the means +/- SD from three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35458235), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RNF182 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
1:50 - 1:200
Knockdown Validated
Reported in scientific literature (PMID:35458235)
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended..
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RNF182
Alternate Names
E3 ubiquitin-protein ligase RNF182, EC 6.3.2.-, FLJ40772, ring finger protein 182MGC33993
Gene Symbol
RNF182
Additional RNF182 Products
Product Documents for RNF182 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RNF182 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RNF182 Antibody - BSA Free
Customer Reviews for RNF182 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RNF182 Antibody - BSA Free and earn rewards!
Have you used RNF182 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...