RNF19B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14688

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: AQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPRAQGAPSPSAHMNLSALAEGQTVLKPEGGEA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RNF19B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RNF19B Antibody [NBP2-14688]

Immunocytochemistry/ Immunofluorescence: RNF19B Antibody [NBP2-14688]

Immunocytochemistry/Immunofluorescence: RNF19B Antibody [NBP2-14688] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: RNF19B Antibody [NBP2-14688]

Immunohistochemistry-Paraffin: RNF19B Antibody [NBP2-14688]

Immunohistochemistry-Paraffin: RNF19B Antibody [NBP2-14688] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

Applications for RNF19B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF19B

Alternate Names

IBRDC3, NKLAM, RNF19B ring finger protein 19B

Gene Symbol

RNF19B

Additional RNF19B Products

Product Documents for RNF19B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF19B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF19B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF19B Antibody - BSA Free and earn rewards!

Have you used RNF19B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF19B Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I'm interested to know if your RNF19B antibody works well for western blotting applications? I am currently working on a project characterizing this protein as an interferon induced gene product, but other antibodies I have tried have not shown an interferon-induced band at the proper molecular weight.

    A:

    Our product NBP2-14688 (RNF19B) has not yet been validated in western blot. I therefore cannot tell you with certainty if the antibody will recognize the interferon-induced band. The datasheet includes the immunogen sequence this antibody was made to, and if you would like to try it in western blot, you can qualify for our Innovator's Reward program. In exchange for your experimental review of an untested application or species, we would issue you a credit for the purchase price of the antibody. Contact us at innovators@novusbio.com for more information.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...