RNPC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86780

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RNPC1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human RNPC1. Peptide sequence: LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RNPC1 Antibody - BSA Free

Western Blot: RNPC1 Antibody [NBP2-86780]

Western Blot: RNPC1 Antibody [NBP2-86780]

Western Blot: RNPC1 Antibody [NBP2-86780] - Host: Rabbit. Target Name: RBM38. Sample Tissue: Human A549. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: RNPC1 Antibody [NBP2-86780]

Immunohistochemistry-Paraffin: RNPC1 Antibody [NBP2-86780]

Immunohistochemistry-Paraffin: RNPC1 Antibody [NBP2-86780] - Rabbit Anti-RBM38 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for RNPC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNPC1

RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2

Alternate Names

CLL-associated antigen KW-5, HSRNASEBRRM) containing 1, RNA binding motif protein 38, RNA-binding motif protein 38, RNA-binding protein 38, RNA-binding region containing protein 1, RNA-binding region-containing protein 1, SEB4, seb4B, ssDNA binding protein SEB4, ssDNA-binding protein SEB4

Gene Symbol

RBM38

Additional RNPC1 Products

Product Documents for RNPC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNPC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNPC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNPC1 Antibody - BSA Free and earn rewards!

Have you used RNPC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies