RPL19 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-16045
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL19 (NP_000972.1). MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RPL19 Antibody - Azide and BSA Free
Western Blot: RPL19 AntibodyAzide and BSA Free [NBP3-16045]
Western Blot: RPL19 Antibody [NBP3-16045] - Analysis of extracts of various cell lines, using RPL19 antibody (NBP3-16045) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Immunocytochemistry/ Immunofluorescence: RPL19 Antibody - Azide and BSA Free [NBP3-16045]
Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of U2OS cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: RPL19 Antibody - Azide and BSA Free [NBP3-16045]
Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of NIH/3T3 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: RPL19 Antibody - Azide and BSA Free [NBP3-16045]
Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of PC-12 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry-Paraffin: RPL19 Antibody - Azide and BSA Free [NBP3-16045]
Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Mouse kidney using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Applications for RPL19 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: RPL19
Alternate Names
DKFZp779D216, FLJ27452, MGC71997,60S ribosomal protein L19, ribosomal protein L19, ribosomal protein L19, cytosolic, N-terminus truncated
Gene Symbol
RPL19
Additional RPL19 Products
Product Documents for RPL19 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RPL19 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RPL19 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review RPL19 Antibody - Azide and BSA Free and earn rewards!
Have you used RPL19 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...