RPL34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81331

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL34 Antibody - BSA Free

Western Blot: RPL34 Antibody [NBP1-81331]

Western Blot: RPL34 Antibody [NBP1-81331]

Western Blot: RPL34 Antibody [NBP1-81331] - Analysis in human cell line NB4.
Immunocytochemistry/ Immunofluorescence: RPL34 Antibody [NBP1-81331]

Immunocytochemistry/ Immunofluorescence: RPL34 Antibody [NBP1-81331]

Immunocytochemistry/Immunofluorescence: RPL34 Antibody [NBP1-81331] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.
RPL34 Antibody - BSA Free Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

The staining of the human pancreas shows strong cytoplasmic-membranous positivity in exocrine glandular cells and moderate cytoplasmic-membranous positivity in endocrine glandular cells.
RPL34 Antibody - BSA Free Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Staining of human stomach shows moderate cytoplasmic-membranous positivity in glandular cells.
RPL34 Antibody - BSA Free Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

The staining of human small intestine shows moderate cytoplasmic-membranous positivity in glandular cells.
RPL34 Antibody - BSA Free Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Immunohistochemistry-Paraffin: RPL34 Antibody [NBP1-81331]

Staining of human testis shows moderate cytoplasmic positivity in leydig cells and weak cytoplasmic positivity in cells in seminiferous duct.

Applications for RPL34 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL34

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L34E family of ribosomal proteins. It is located in the cytoplasm. This gene originally was thought to be located at 17q21, but it has been mapped to 4q. Transcript variants derived from alternative splicing, alternative transcription initiation sites, and/or alternative polyadenylation exist; these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Alternate Names

leukemia-associated protein, M, MGC111005, ribosomal protein L34,60S ribosomal protein L34

Gene Symbol

RPL34

Additional RPL34 Products

Product Documents for RPL34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL34 Antibody - BSA Free and earn rewards!

Have you used RPL34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...