RPS20 Antibody (9H1D4)

Novus Biologicals | Catalog # NBP3-16824

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9H1D4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPS20 (P60866). MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS20 Antibody (9H1D4)

RPS20 Antibody (9H1D4)

Immunoprecipitation: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunoprecipitation: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunoprecipitation of RPS20 in 300 ug extracts from Hep G2 cells using 3 ug RPS20 Rabbit mAb. Western blot analysis was performed using RPS20 Rabbit mAb at 1:1000 dilution.
Western Blot: RPS20 Antibody (9H1D4) [NBP3-16824]

Western Blot: RPS20 Antibody (9H1D4) [NBP3-16824]

Western Blot: RPS20 Antibody (9H1D4) [NBP3-16824] - Western blot analysis of extracts of various cell lines, using RPS20 Rabbit mAb (NBP3-16824) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: RPS20 Antibody (9H1D4) [NBP3-16824]

Immunocytochemistry/ Immunofluorescence: RPS20 Antibody (9H1D4) [NBP3-16824]

Immunocytochemistry/Immunofluorescence: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunofluorescence analysis of C6 cells using RPS20 Rabbit mAb (NBP3-16824) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
RPS20 Antibody (9H1D4)

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded rat brain tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RPS20 Antibody (9H1D4)

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse brain tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RPS20 Antibody (9H1D4)

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse testis tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RPS20 Antibody (9H1D4)

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded human colon carcinoma tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RPS20 Antibody (9H1D4)

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] -

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded rat colon tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for RPS20 Antibody (9H1D4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPS20

Mammalian ribosomal proteins are encoded by multigene families that consist of processed pseudogenes and one functional intron-containing gene within their coding regions. Ribosomal Protein S20, also known as RPS20, is a 119 amino acid cytoplasmic protein that is a component of the 40S ribosomal subunit. Co-transcribed with the small nucleolar RNA gene U54, Ribosomal Protein S20 is a primary binding protein (it binds independently to its target protein) that interacts with both the 5' and 3' minor domains of 16S ribosomal RNA (rRNA). Through its interactions with 16S rRNA, Ribosomal Protein S20 is thought to play a key role in nucleating the assembly of the 30S ribosomal subunit. Like most ribosomal protein-coding genes, the gene encoding Ribosomal Protein S20 is dispersed throughout the genome and exists as multiple processed pseudogenes.

Alternate Names

40S ribosomal protein S20, FLJ27451, MGC102930, ribosomal protein S20

Gene Symbol

RPS20

Additional RPS20 Products

Product Documents for RPS20 Antibody (9H1D4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS20 Antibody (9H1D4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS20 Antibody (9H1D4)

There are currently no reviews for this product. Be the first to review RPS20 Antibody (9H1D4) and earn rewards!

Have you used RPS20 Antibody (9H1D4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...