RPS25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80802

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RPS25 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS25 Antibody - BSA Free

Western Blot: RPS25 Antibody [NBP1-80802]

Western Blot: RPS25 Antibody [NBP1-80802]

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
Western Blot: RPS25 Antibody [NBP1-80802]

Western Blot: RPS25 Antibody [NBP1-80802]

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human heart muscle shows weak to moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human cervix, uterine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802]

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
RPS25 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: RPS25 Antibody [NBP1-80802]

Immunocytochemistry/ Immunofluorescence: RPS25 Antibody [NBP1-80802]

Staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.

Applications for RPS25 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS25

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Alternate Names

ribosomal protein S25,40S ribosomal protein S25

Entrez Gene IDs

6230 (Human)

Gene Symbol

RPS25

UniProt

P62851 (Human)

Additional RPS25 Products

Product Documents for RPS25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPS25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RPS25 Antibody - BSA Free

Customer Reviews for RPS25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS25 Antibody - BSA Free and earn rewards!

Have you used RPS25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies